EPHA3 monoclonal antibody (M02), clone 3E9

• Catalog Number: orb2293218
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHA3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP
• NCBI: AAH63282
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EPHA3 is approximately 0.3 ng/ml as a capture antibody.

EPHA3 monoclonal antibody (M02), clone 3E9 Western Blot analysis of EPHA3 expression in HeLa.

Western Blot detection against Immunogen (39.38 KDa).