EPHA3 monoclonal antibody (M01), clone 3A12

• Catalog Number: orb2293219
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHA3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A12
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP
• NCBI: AAH63282
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EPHA3 is approximately 0.03 ng/ml as a capture antibody.

EPHA3 monoclonal antibody (M01), clone 3A12. Western Blot analysis of EPHA3 expression in human spleen.

Western blot analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with EPHA3 monoclonal antibody (M01) clone 3A12 (Cat # orb2293219). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (39.38 KDa).