You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292633 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human EPCAM protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | EPCAM (NP_002345.1, 1 a.a. ~ 314 a.a) full-length human protein. |
Protein Sequence | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_002345.1 |
EPCAM MaxPab rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in A-431.
EPCAM MaxPab rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in human pancreas.
Western Blot analysis of EPCAM expression in transfected 293T cell line by EPCAM MaxPab polyclonal antibody. Lane 1: EPCAM transfected lysate (34.90 KDa). Lane 2: Non-transfected lysate.