You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293220 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EPB42. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2G12 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | EPB42 (NP_000110.1, 623 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA |
NCBI | NP_000110.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to EPB42 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12. Lane 1: EPB42 transfected lysate (69.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).