EP300 monoclonal antibody (M02), clone 1D2

• Catalog Number: orb2293225
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EP300.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D2
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1
• Immunogen: EP300 (NP_001420, 731 a.a. ~ 830 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
• NCBI: NP_001420
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EP300 is approximately 0.03 ng/ml as a capture antibody.

EP300 monoclonal antibody (M02), clone 1D2 Western Blot analysis of EP300 expression in Hela S3 NE.

Immunofluorescence of monoclonal antibody to EP300 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).