You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294799 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ENTPD3 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | ENTPD3 (AAH29869.1, 1 a.a. ~ 452 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEE |
NCBI | AAH29869.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ENTPD3 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENTPD3 expression in mouse testis.
Western Blot analysis of ENTPD3 expression in transfected 293T cell line by ENTPD3 MaxPab polyclonal antibody. Lane 1: ENTPD3 transfected lysate(50.70 KDa). Lane 2: Non-transfected lysate.