ENTPD3 monoclonal antibody (M02), clone 2A4

• Catalog Number: orb2294797
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ENTPD3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ENTPD3 (NP_001239, 107 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG
• Tested applications: ELISA
• Clone Number: 2A4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001239

Detection limit for recombinant GST tagged ENTPD3 is 1 ng/ml as a capture antibody.