You have no items in your shopping cart.
Cart summary
Enterotoxin type H Protein, S. aureus, Recombinant (His)
Catalog Number: orb1976372
| Catalog Number | orb1976372 |
|---|---|
| Category | Proteins |
| Description | Enterotoxin type H Protein, S. aureus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.1 kDa and the accession number is P0A0M0. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 27.1 kDa (predicted) |
| UniProt ID | P0A0M0 |
| Protein Sequence | EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Staphylococcus aureus |
| Biological Activity | Enterotoxin type H Protein, S. aureus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 27.1 kDa and the accession number is P0A0M0. |
| Expression Region | 25-241 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
