You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976373 |
---|---|
Category | Proteins |
Description | Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Enterotoxin type G Protein, S. aureus (strain N315), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.0 kDa and the accession number is P0A0L7. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 29.0 kDa (predicted) |
UniProt ID | P0A0L7 |
Protein Sequence | QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH |
Expression System | P. pastoris (Yeast) |
Biological Origin | Staphylococcus aureus |
Biological Activity | Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Enterotoxin type G Protein, S. aureus (strain N315), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.0 kDa and the accession number is P0A0L7. |
Expression Region | 26-258 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |
98.00% | |
43.0 kDa (predicted) |