ENSA monoclonal antibody (M02), clone 1H7

• Catalog Number: orb2293228
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ENSA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: ENSA (AAH00436, 1 a.a. ~ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
• NCBI: AAH00436
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ENSA is approximately 0.1 ng/ml as a capture antibody.

ENSA monoclonal antibody (M02), clone 1H7 Western Blot analysis of ENSA expression in K-562.

Western Blot detection against Immunogen (39.05 KDa).