ENSA monoclonal antibody (M01A), clone 1E8

• Catalog Number: orb2293229
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant ENSA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ENSA (AAH00436, 1 a.a. ~ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
• NCBI: AAH00436
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ENSA monoclonal antibody (M01A), clone 1E8 Western Blot analysis of ENSA expression in COLO 320 HSR.

Western Blot detection against Immunogen (39.05 KDa).