ENO3 monoclonal antibody (M01), clone 5D1

• Catalog Number: orb2293230
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ENO3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5D1
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
• NCBI: NP_001967
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ENO3 is approximately 0.03 ng/ml as a capture antibody.

ENO3 monoclonal antibody (M01), clone 5D1 Western Blot analysis of ENO3 expression in HeLa.

Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]

Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01), clone 5D1. Lane 1: ENO3 transfected lysate (46.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody (M01), clone 5D1 (Cat # orb2293230). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (31.24 KDa).