You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293231 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ENO2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1A3 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | ENO2 (AAH02745, 325 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL |
NCBI | AAH02745 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged ENO2 is approximately 0.1 ng/ml as a capture antibody.
ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in different cell lines.
ENO2 monoclonal antibody (M01), clone 1A3. Western Blot analysis of ENO2 expression in HeLa.
Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody (M01), clone 1A3. Lane 1: ENO2 transfected lysate (47.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.84 KDa).