You have no items in your shopping cart.
Cart summary
Endolysin Protein, Enterobacteria phage T4, Recombinant (His & SUMO)
Catalog Number: orb1979387
| Catalog Number | orb1979387 |
|---|---|
| Category | Proteins |
| Description | Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 34.6 kDa (predicted) |
| UniProt ID | P00720 |
| Protein Sequence | MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL |
| Expression System | E. coli |
| Biological Origin | Enterobacteria phage T4 |
| Biological Activity | Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer. |
| Expression Region | 1-164 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
