ENC1 monoclonal antibody (M02), clone 3B1

• Catalog Number: orb2291880
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ENC1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
• NCBI: NP_003624
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (34.76 KDa).

ENC1 monoclonal antibody (M02), clone 3B1 Western Blot analysis of ENC1 expression in IMR-32.

Detection limit for recombinant GST tagged ENC1 is approximately 0.3 ng/ml as a capture antibody.