You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293239 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant EN1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F5 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE* |
NCBI | NP_001417 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EN1 is approximately 1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to EN1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (40.08 KDa).