EN1 monoclonal antibody (M04), clone 3H2

• Catalog Number: orb2293240
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant EN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H2
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*
• NCBI: NP_001417
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EN1 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to EN1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (40.08 KDa).