ELK3 monoclonal antibody (M02), clone 3A12

• Catalog Number: orb2293249
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ELK3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A12
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ELK3 (NP_005221.2, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
• NCBI: NP_005221.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ELK3 is approximately 0.3 ng/ml as a capture antibody.

Western Blot analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody (M02), clone 3A12. Lane 1: ELK3 transfected lysate (44.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).