ELAVL4 Antibody

• Catalog Number: orb316561
• Category: Antibodies
• Description: ELAVL4 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Bovine, Monkey, Rabbit
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunofluorescence, 2μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 41770 MW
• UniProt ID: P26378
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: ELAV-like protein 4;Hu-antigen D;HuD;Paraneoplasti
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of ELAVL4 using anti-ELAVL4 antibody.Lane 1:rat brain tissue;2:mouse brain tissue;3:U87-MG cell.

IF analysis of ELAVL4 using anti-ELAVL4 antibody.ELAVL4 was detected in paraffin-embedded section of human glioma tissues.

IHC analysis of ELAVL4 using anti-ELAVL4 antibody.ELAVL4 was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of ELAVL4 using anti-ELAVL4 antibody.ELAVL4 was detected in paraffin-embedded section of rat brain tissues.

IHC analysis of ELAVL4 using anti-ELAVL4 antibody.ELAVL4 was detected in paraffin-embedded section of human meningeoma tissues.