Item 1 of 5

ELAVL2 HuB Antibody

Catalog Number: orb443175

Catalog Number	orb443175
Category	Antibodies
Description	ELAVL2 HuB Antibody
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	IHC, WB
Reactivity	Human, Mouse, Rat
Isotype	Rabbit IgG
Immunogen	A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK).
Concentration	Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Dilution range	Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Form/Appearance	Lyophilized
Conjugation	Unconjugated
MW	45 kDa
UniProt ID	Q12926
Storage	Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Alternative names	ELAV-like protein 2; ELAV-like neuronal protein 1; Read more...
Note	For research use only
Application notes	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Expiration Date	12 months from date of receipt.

WB analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.Lane 1:human T-47D Cell;2:human A549 Cell;3:human Caco-2 Cell.

IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue.

IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of human glioma tissue.