You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443175 |
---|---|
Category | Antibodies |
Description | ELAVL2 HuB Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 45 kDa |
UniProt ID | Q12926 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | ELAV-like protein 2; ELAV-like neuronal protein 1; Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.Lane 1:human T-47D Cell;2:human A549 Cell;3:human Caco-2 Cell.
IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.ELAVL2 HuB was detected in paraffin-embedded section of human glioma tissue.
ELISA, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Other, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse, Rat, Xenopus | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating