EIF4G2 monoclonal antibody (M01), clone 3B5

• Catalog Number: orb2293266
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF4G2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EIF4G2 (NP_001409, 811 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 3B5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001409

EIF4G2 monoclonal antibody (M01), clone 3B5 Western Blot analysis of EIF4G2 expression in Hela S3 NE.

EIF4G2 monoclonal antibody (M01), clone 3B5. Western Blot analysis of EIF4G2 expression in PC-12.

Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (34.43 KDa).