EIF4G1 monoclonal antibody (M01), clone 3A10

• Catalog Number: orb2293268
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A10
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
• NCBI: NP_886553
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EIF4G1 is 0.03 ng/ml as a capture antibody.

EIF4G1 monoclonal antibody (M01), clone 3A10. Western Blot analysis of EIF4G1 expression in IMR-32.

EIF4G1 monoclonal antibody (M01), clone 3A10. Western Blot analysis of EIF4G1 expression in NIH/3T3.

Western Blot detection against Immunogen (36.74 KDa).