EIF2D monoclonal antibody (M05), clone 2D10

• Catalog Number: orb2293320
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF2D.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EIF2D (NP_008824.2, 485 a.a. ~ 584 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK
• NCBI: NP_008824.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EIF2D is 3 ng/ml as a capture antibody.

EIF2D monoclonal antibody (M05), clone 2D10. Western Blot analysis of EIF2D expression in human liver.

EIF2D monoclonal antibody (M05), clone 2D10. Western Blot analysis of EIF2D expression in MCF-7.

Western Blot analysis of EIF2D expression in transfected 293T cell line by EIF2D monoclonal antibody (M05), clone 2D10. Lane 1: EIF2D transfected lysate (Predicted MW: 64.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).