You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291189 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EHD3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4B7 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI |
NCBI | NP_055415 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EHD3 is approximately 0.1 ng/ml as a capture antibody.
EHD3 monoclonal antibody (M01), clone 4B7 Western Blot analysis of EHD3 expression in IMR-32.
EHD3 monoclonal antibody (M01), clone 4B7. Western Blot analysis of EHD3 expression in COLO 320 HSR.
EHD3 monoclonal antibody (M01), clone 4B7. Western Blot analysis of EHD3 expression in MCF-7.
Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25 ug/ml]
Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (31.24 KDa).