EGR1 monoclonal antibody (M08), clone 1F5

• Catalog Number: orb2293291
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant EGR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR*
• NCBI: NP_001955
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EGR1 monoclonal antibody (M08), clone 1F5 Western Blot analysis of EGR1 expression in 293.

Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (38.21 KDa).