You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293291 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant EGR1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F5 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR* |
NCBI | NP_001955 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EGR1 monoclonal antibody (M08), clone 1F5 Western Blot analysis of EGR1 expression in 293.
Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (38.21 KDa).