EGR1 monoclonal antibody (M03), clone 6E8

• Catalog Number: orb2293296
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EGR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6E8
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
• NCBI: NP_001955
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EGR1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysate (59.73 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).