EFNA5 monoclonal antibody (M01), clone 1F12

• Catalog Number: orb2293312
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EFNA5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F12
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: EFNA5 (NP_001953, 114 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• NCBI: NP_001953
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EFNA5 is approximately 0.03 ng/ml as a capture antibody.

EFNA5 monoclonal antibody (M01), clone 1F12. Western Blot analysis of EFNA5 expression in IMR-32.

Western Blot detection against Immunogen (35.64 KDa).