You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290797 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant EFHD1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1H7 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN |
NCBI | NP_079478.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EFHD1 monoclonal antibody (M05), clone 1H7 Western Blot analysis of EFHD1 expression in HeLa.
EFHD1 monoclonal antibody (M05), clone 1H7. Western Blot analysis of EFHD1 expression in NIH/3T3.
EFHD1 monoclonal antibody (M05), clone 1H7. Western Blot analysis of EFHD1 expression in PC-12.
EFHD1 monoclonal antibody (M05), clone 1H7. Western Blot analysis of EFHD1 expression in Raw 264.7.
Immunofluorescence of monoclonal antibody to EFHD1 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to EFHD1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (33.44 KDa).