Cart summary

You have no items in your shopping cart.

    EEF2 Antibody (monoclonal, 5F5)

    Catalog Number: orb692233

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb692233
    CategoryAntibodies
    DescriptionEEF2 Antibody (monoclonal, 5F5)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number5F5
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeMouse IgG1
    ImmunogenA synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Huma Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human, Mouse, Rat
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW95 kDa
    UniProt IDP13639
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    EEF2 Antibody (monoclonal, 5F5)

    Western blot analysis of EEF2 using anti-EEF2 antibody (orb692233). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HeLa whole cell lysates, Lane 2: human HEPG2 whole cell lysates, Lane 3: human Jurkat whole cell lysates, Lane 4: human U20S whole cell lysates, Lane 5: rat PC-12 whole cell lysates, Lane 6: mouse NIH/3T3 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-EEF2 antigen affinity purified monoclonal antibody (Catalog # orb692233) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for EEF2 at approximately 95KD. The expected band size for EEF2 is at 95KD.

    EEF2 Antibody (monoclonal, 5F5)

    IHC analysis of EEF2 using anti-EEF2 antibody (orb692233). EEF2 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-EEF2 Antibody (orb692233) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.

    EEF2 Antibody (monoclonal, 5F5)

    IHC analysis of EEF2 using anti-EEF2 antibody (orb692233). EEF2 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-EEF2 Antibody (orb692233) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.

    EEF2 Antibody (monoclonal, 5F5)

    IHC analysis of EEF2 using anti-EEF2 antibody (orb692233). EEF2 was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-EEF2 Antibody (orb692233) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.

    EEF2 Antibody (monoclonal, 5F5)

    IHC analysis of EEF2 using anti-EEF2 antibody (orb692233). EEF2 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-EEF2 Antibody (orb692233) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.

    EEF2 Antibody (monoclonal, 5F5)

    IF analysis of EEF2 using anti-EEF2 antibody (orb692233). EEF2 was detected in immunocytochemical section of HEPG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti-EEF2 Antibody (orb692233) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

    EEF2 Antibody (monoclonal, 5F5)

    Flow Cytometry analysis of HEPA1-6 cells using anti-EEF2 antibody (orb692233). Overlay histogram showing HEPA1-6 cells stained with orb692233 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-EEF2 Antibody (orb692233, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    EEF2 Antibody (monoclonal, 5F5)

    Flow Cytometry analysis of HL-60 cells using anti-EEF2 antibody (orb692233). Overlay histogram showing HL-60 cells stained with orb692233 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-EEF2 Antibody (orb692233, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    EEF2 Antibody (monoclonal, 5F5)

    Flow Cytometry analysis of NRK cells using anti-EEF2 antibody (orb692233). Overlay histogram showing NRK cells stained with orb692233 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-EEF2 Antibody (orb692233, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars