You have no items in your shopping cart.
Cart summary
EEF1B2 Recombinant Protein (Human)
Catalog Number: orb2051207
| Catalog Number | orb2051207 |
|---|---|
| Category | Proteins |
| Description | EEF1B2 Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 51.8 kDa |
| UniProt ID | P24534 |
| Protein Sequence | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI |
| Source | E.coli |
| NCBI | NP_001032752 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | EEF1B;EEF1B1;EF1B;EF-1-beta;elongation factor 1-be Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human EEF1B2 protein [orb54499]
Greater than 90% as determined by SDS-PAGE.
51.8 kDa
E.coli
20 μg, 100 μg, 1 mgEEF1B2 Recombinant Protein (Human) [orb2051206]
Greater than 90% as determined by SDS-PAGE.
51.8 kDa
E.coli
20 μgEEF1B2 Recombinant Protein (Human) [orb2051208]
Greater than 90% as determined by SDS-PAGE.
51.8 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
