You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293338 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant EEF1B2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3F9 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI |
NCBI | AAH00211 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EEF1B2 monoclonal antibody (M12), clone 3F9. Western Blot analysis of EEF1B2 expression in HepG2.
EEF1B2 monoclonal antibody (M12), clone 3F9. Western Blot analysis of EEF1B2 expression in NIH/3T3.
EEF1B2 monoclonal antibody (M12), clone 3F9. Western Blot analysis of EEF1B2 expression in PC-12.
EEF1B2 monoclonal antibody (M12), clone 3F9. Western Blot analysis of EEF1B2 expression in Raw 264.7.
Western Blot detection against Immunogen (50.49 KDa).