EEF1A2 polyclonal antibody (A01)

• Catalog Number: orb2293341
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: 50 % glycerol
• Immunogen: EEF1A2 (NP_001949, 364 a.a. ~ 462 a.a) partial recombinant protein with GST tag.
• Protein Sequence: HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG
• Tested applications: ELISA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001949

EEF1A2 polyclonal antibody (A01), Western Blot analysis of EEF1A2 expression in Hela S3 NE.

EEF1A2 polyclonal antibody (A01), Western Blot analysis of EEF1A2 expression in human thyroid (diffuse hyperplasia).

EEF1A2 polyclonal antibody (A01), Western Blot analysis of EEF1A2 expression in NIH/3T3.

EEF1A2 polyclonal antibody (A01), Western Blot analysis of EEF1A2 expression in PC-12.

Western Blot detection against Immunogen (37 KDa).