You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291895 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EEA1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1D4 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG |
Immunogen | EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
NCBI | NP_003557 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EEA1 monoclonal antibody (M02A), clone 1D4 Western Blot analysis of EEA1 expression in A-431.
EEA1 monoclonal antibody (M02A), clone 1D4. Western Blot analysis of EEA1 expression in NIH/3T3.
EEA1 monoclonal antibody (M02A), clone 1D4. Western Blot analysis of EEA1 expression in PC-12.
EEA1 monoclonal antibody (M02A), clone 1D4. Western Blot analysis of EEA1 expression in Raw 264.7.
Western Blot detection against Immunogen (36.74 KDa).