EDNRA monoclonal antibody (M02), clone 2A5

• Catalog Number: orb2293350
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EDNRA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
• NCBI: AAH22511
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EDNRA is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody (M02), clone 2A5. Lane 1: EDNRA transfected lysate (48.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (32.56 KDa).