EDN3 monoclonal antibody (M01), clone 2A6-2A4

• Catalog Number: orb2293352
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant EDN3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EDN3 (AAH08876, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
• Tested applications: ELISA, IP, WB
• Clone Number: 2A6-2A4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH08876

Detection limit for recombinant GST tagged EDN3 is approximately 0.3 ng/ml as a capture antibody.

EDN3 monoclonal antibody (M01), clone 2A6-2A4 Western Blot analysis of EDN3 expression in LNCaP.

Immunoprecipitation of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody (M01), clone 2A6-2A4. Lane 1: EDN3 transfected lysate (25.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (51.92 KDa).