EDN2 monoclonal antibody (M01), clone 3B4-1C5

• Catalog Number: orb2293355
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant EDN2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B4-1C5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: EDN2 (AAH34393, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
• NCBI: AAH34393
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of EDN2 expression in transfected 293T cell line by EDN2 monoclonal antibody (M01), clone 3B4-1C5. Lane 1: EDN2 transfected lysate (20 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (45.32 KDa).