You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293357 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EDN1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3D6 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG2a kappa |
Immunogen | EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW |
NCBI | AAH09720 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EDN1 is approximately 0.3 ng/ml as a capture antibody.
Immunoprecipitation of EDN1 transfected lysate using anti-EDN1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN1 MaxPab rabbit polyclonal antibody.
Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody (M01), clone 3D6. Lane 1: EDN1 transfected lysate (24 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).