EDN1 monoclonal antibody (M01), clone 3D6

• Catalog Number: orb2293357
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EDN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D6
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a kappa
• Immunogen: EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
• NCBI: AAH09720
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EDN1 is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of EDN1 transfected lysate using anti-EDN1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody (M01), clone 3D6. Lane 1: EDN1 transfected lysate (24 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).