You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290896 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human EDA2R protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | EDA2R (NP_068555.1, 1 a.a. ~ 297 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP |
NCBI | NP_068555.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EDA2R MaxPab rabbit polyclonal antibody. Western Blot analysis of EDA2R expression in mouse liver.
Western Blot analysis of EDA2R expression in transfected 293T cell line by EDA2R MaxPab polyclonal antibody. Lane 1: EDA2R transfected lysate (32.70 KDa). Lane 2: Non-transfected lysate.