EBF3 monoclonal antibody (M05), clone 8D6

• Catalog Number: orb2290588
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EBF3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 8D6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001005463
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EBF3 is approximately 0.03 ng/ml as a capture antibody.

EBF3 monoclonal antibody (M05), clone 8D6 Western Blot analysis of EBF3 expression in IMR-32.

EBF3 monoclonal antibody (M05), clone 8D6. Western Blot analysis of EBF3 expression in NIH/3T3.

Immunoperoxidase of monoclonal antibody to EBF3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 0.3 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).