Cart summary

You have no items in your shopping cart.

E2F4 Peptide - N-terminal region

E2F4 Peptide - N-terminal region

Catalog Number: orb1998677

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998677
CategoryProteins
DescriptionE2F4 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTL
UniProt IDQ16254
MW45 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesEukaryota, Metazoa, Chordata, Craniata, Vertebrata
Read more...
NoteFor research use only
NCBINP_001941.2