E2F3 monoclonal antibody (M01), clone 5F7

• Catalog Number: orb2293410
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant E2F3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: E2F3 (NP_001940, 336 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNL
• Tested applications: ELISA, PLA, WB
• Clone Number: 5F7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001940

Detection limit for recombinant GST tagged E2F3 is 0.03 ng/ml as a capture antibody.

Detection limit for recombinant GST tagged E2F3 is 0.1 ng/ml as a capture antibody.

E2F3 monoclonal antibody (M01), clone 5F7 Western Blot analysis of E2F3 expression in COLO 320 HSR.

Proximity Ligation Analysis of protein-protein interactions between MSH2 and E2F3. HeLa cells were stained with anti-MSH2 rabbit purified polyclonal 1:1200 and anti-E2F3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.01 KDa).