DYRK1A monoclonal antibody (M01), clone 7D10

• Catalog Number: orb2293416
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DYRK1A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7D10
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b Kappa
• Immunogen: DYRK1A (NP_001387, 674 a.a. ~ 763 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
• NCBI: NP_001387
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DYRK1A is approximately 0.03 ng/ml as a capture antibody.

DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in K-562.

DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in Raw 264.7.

Western Blot detection against Immunogen (35.53 KDa).