You have no items in your shopping cart.
Cart summary
Item 1 of 1
DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)
Catalog Number: orb2293539
| Catalog Number | orb2293539 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human DYNC1H1 protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Reactivity | Human |
| Immunogen | DYNC1H1 (AAH64521.1, 1 a.a. ~ 197 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV |
| NCBI | AAH64521.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot analysis of DYNC1H1 expression in transfected 293T cell line by DYNC1H1 MaxPab polyclonal antibody. Lane 1: DYNC1H1 transfected lysate (22.20 KDa). Lane 2: Non-transfected lysate.
