DVL3 monoclonal antibody (M04), clone 4H2

• Catalog Number: orb2293418
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DVL3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4H2
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: DVL3 (AAH32459, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP
• NCBI: AAH32459
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DVL3 is approximately 0.3 ng/ml as a capture antibody.

DVL3 monoclonal antibody (M04), clone 4H2 Western Blot analysis of DVL3 expression in A-431.

Immunofluorescence of monoclonal antibody to DVL3 on A-431 cell. [antibody concentration 10 ug/ml]

Western Blot analysis of DVL3 expression in transfected 293T cell line by DVL3 monoclonal antibody (M04), clone 4H2. Lane 1: DVL3 transfected lysate (78 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of DVL3 over-expressed 293 cell line, cotransfected with DVL3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DVL3 monoclonal antibody (M04), clone 4H2 (Cat # orb2293418). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).