DUT monoclonal antibody (M01), clone 1C9

• Catalog Number: orb2293427
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DUT.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: DUT (AAH33645, 68 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: TDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 1C9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH33645

Detection limit for recombinant GST tagged DUT is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to DUT on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to DUT on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]

Western Blot analysis of DUT expression in transfected 293T cell line by DUT monoclonal antibody (M01), clone 1C9. Lane 1: DUT transfected lysate (18 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.3 KDa).