You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
DUSP5 monoclonal antibody (M04), clone 2F3
Catalog Number: orb2293443
| Catalog Number | orb2293443 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant DUSP5. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2b Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human, Rat |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
| Tested applications | ELISA, IF, WB |
| Clone Number | 2F3 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_004410 |
Western Blot detection against Immunogen (36.63 KDa).
Detection limit for recombinant GST tagged DUSP5 is approximately 1 ng/ml as a capture antibody.
DUSP5 monoclonal antibody (M04), clone 2F3 Western Blot analysis of DUSP5 expression in K-562.
Immunofluorescence of monoclonal antibody to DUSP5 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of DUSP5 expression in transfected 293T cell line by DUSP5 monoclonal antibody (M04), clone 2F3. Lane 1: DUSP5 transfected lysate (Predicted MW: 42.1 KDa). Lane 2: Non-transfected lysate.
