DTYMK monoclonal antibody (M01A), clone 2C2

• Catalog Number: orb2293458
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DTYMK.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgM Kappa
• Immunogen: DTYMK (NP_036277, 103 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
• NCBI: NP_036277
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of DTYMK expression in transfected 293T cell line by DTYMK monoclonal antibody (M01A), clone 2C2. Lane 1: DTYMK transfected lysate (Predicted MW: 23.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).