DTNB polyclonal antibody (A01)

• Catalog Number: orb2293464
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant DTNB.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: 50 % glycerol
• Immunogen: DTNB (NP_899205, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
• Protein Sequence: MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY
• Tested applications: ELISA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_899205

DTNB polyclonal antibody (A01), Western Blot analysis of DTNB expression in HepG2.

Western Blot detection against Immunogen (35.9 KDa).