You have no items in your shopping cart.
Cart summary
DSP Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb1978696
| Catalog Number | orb1978696 |
|---|---|
| Category | Proteins |
| Description | Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes. DSP Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 42.1 kDa and the accession number is P15924. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 42.1 kDa (predicted) |
| UniProt ID | P15924 |
| Protein Sequence | CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes. DSP Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 42.1 kDa and the accession number is P15924. |
| Expression Region | 78-300 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
