DR4/TNFRSF10A Antibody

• Catalog Number: orb389434
• Category: Antibodies
• Description: DR4/TNFRSF10A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/mlWestern blot, 0.1-0.5μg/mlFlow Cytometry, 1-3μg/1x106cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 50089 MW
• UniProt ID: O00220
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tumor necrosis factor receptor superfamily member
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-DR4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of DR4 using anti-DR4 antibody.Lane 1:rat spleen tissue;2:mouse spleen tissue;3:MCF-7 cell.

IF analysis of ATG14L using anti-ATG14L antibody. ATG14L was detected in an immunocytochemical section of U2OS cells.